PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.158040.1
Common NameCsa_5G637800, WRKY37
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 507aa    MW: 55206.8 Da    PI: 8.1559
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.158040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.72.8e-34233289259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK vkgsefprsYY+Ct+ +Cpvkkk+ers  d++++ei+Y+g+Hnhe
  Cucsa.158040.1 233 DDGYNWRKYGQKLVKGSEFPRSYYKCTHLNCPVKKKIERSP-DGQITEIIYKGQHNHE 289
                     8****************************************.***************8 PP

2WRKY106.11.8e-33392450159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+vers++d k+v++tYeg+Hnh+
  Cucsa.158040.1 392 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERSSTDSKAVVTTYEGKHNHD 450
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.835227291IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-29229291IPR003657WRKY domain
SuperFamilySSF1182903.4E-26230291IPR003657WRKY domain
SMARTSM007747.0E-38232290IPR003657WRKY domain
PfamPF031065.5E-26233289IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-36378452IPR003657WRKY domain
SuperFamilySSF1182905.36E-29384452IPR003657WRKY domain
PROSITE profilePS5081139.02387452IPR003657WRKY domain
SMARTSM007745.8E-39392451IPR003657WRKY domain
PfamPF031061.7E-25393450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAKKDDSATR PPLQRPTITL PPRPSMEAFF TGGPTGVSPG PMTLLSSYFA DGAVDSPSFS  60
QLLAGAMASP MAMGFFGTGS TPNYYAKDGP ASELEFGMKQ SKPVNLVVAR SPLFSVPPGL  120
SPSGLLNSPG FYPPQSPFGM SHQQALAQVT AQAALANSHM HMQQAEYQHS SVPAPTEPLV  180
RDPSFSLDDA SQLAIIPSTS DTKSLIAEST EVSHSDRKYQ PPPPPHGSDK PADDGYNWRK  240
YGQKLVKGSE FPRSYYKCTH LNCPVKKKIE RSPDGQITEI IYKGQHNHEP PPANKRARDN  300
IEPAGCTNSL IKPECGLQNQ AGILNKSSEN VQLGSSDSEG RADTEITDDR DEDEPNPKRQ  360
NIDAGTSGVA LSHKTLTEPK IIVQTRSEVD LLDDGYRWRK YGQKVVKGNP NPRSYYKCTS  420
AGCNVRKHVE RSSTDSKAVV TTYEGKHNHD VPAARNSSHH TVNNTVHHIK PLKVVAQKHP  480
LLKEMEFGTN DQRPAVLQLK EEQITV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-38233453878Probable WRKY transcription factor 4
2lex_A4e-38233453878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840290.0GU984029.1 Cucumis sativus WRKY protein (WRKY37) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267707.10.0probable WRKY transcription factor 3-like
SwissprotQ9ZQ701e-145WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLE7CEX80.0E7CEX8_CUCSA; Uncharacterized protein
STRINGGLYMA18G49830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-131WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  5. Kim DJ,Smith SM,Leaver CJ
    A cDNA encoding a putative SPF1-type DNA-binding protein from cucumber.
    Gene, 1997. 185(2): p. 265-9
    [PMID:9055825]